SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004626 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004626
Domain Number 1 Region: 27-168
Classification Level Classification E-value
Superfamily EF-hand 3.11e-36
Family Calmodulin-like 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004626   Gene: ENSPANG00000011909   Transcript: ENSPANT00000009625
Sequence length 173
Comment pep:known_by_projection chromosome:PapAnu2.0:1:3409723:3413338:-1 gene:ENSPANG00000011909 transcript:ENSPANT00000009625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNVKDDELDAMLKEASGPINFTMFLNMFGEKLSGTDAEETILNAFKMLDPDGKGKI
NKEYIKRLLMSQADKMTADEVDQMFQFASIDAAGNLDYKALSYVITHGEEKEE
Download sequence
Identical sequences ENSPANP00000004626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]