SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004649 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004649
Domain Number 1 Region: 47-184
Classification Level Classification E-value
Superfamily TPR-like 7.59e-17
Family Tetratricopeptide repeat (TPR) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004649   Gene: ENSPANG00000003100   Transcript: ENSPANT00000023703
Sequence length 189
Comment pep:known_by_projection chromosome:PapAnu2.0:14:107867023:107870629:1 gene:ENSPANG00000003100 transcript:ENSPANT00000023703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPNDRAVLQAIFNPDTPFGDIVGLDLGEEAEKEERKEDEVFPQAQLEQSKALELQGVM
AAEAGDLSTALERFGQAICLLPERASAYNNRAQARRLQGDVAGALEDLERAVELSGGRGR
AARQSFVQRGLLARLQGRDDDARRDFARAARLGSPFARRQLVLLNPYAALCNRMLADMMG
QLRRPRDSR
Download sequence
Identical sequences A0A096MXM6
ENSPANP00000004649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]