SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004656 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004656
Domain Number 1 Region: 876-1178
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.25e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000123
Further Details:      
 
Domain Number 2 Region: 217-360
Classification Level Classification E-value
Superfamily PH domain-like 1.38e-29
Family Third domain of FERM 0.0077
Further Details:      
 
Domain Number 3 Region: 105-216
Classification Level Classification E-value
Superfamily Second domain of FERM 4.45e-23
Family Second domain of FERM 0.00078
Further Details:      
 
Domain Number 4 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-20
Family First domain of FERM 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004656   Gene: ENSPANG00000003305   Transcript: ENSPANT00000022773
Sequence length 1182
Comment pep:known_by_projection chromosome:PapAnu2.0:1:150576999:150773966:1 gene:ENSPANG00000003305 transcript:ENSPANT00000022773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCTLDQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMNFQSEGDVAE
ALSEQRKEQSQVHRALHSGILPAEAELMYINEVERLDGFGQEIFPVKDNHGNCVHLGIFF
MGIFVRNRIGRQAVIHRWNDMGNITHNKSTILVELINKEETALFHTDDIENAKYISRLFA
TRHKFYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPVHVQCGEHYSETHTSQD
SIFHGNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLNCSQSFIQASPVSSNLSIP
GSDIMRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGILHTDSQSQSLRNLNIINTHA
YNQPEDLVYSQPEMRERHPYTVPYGPQGVYSNKLVSPSDQRNPKNNVVPSKPGASAISHT
VSTPELANMQLQGNHNYSTAHMLKNYLFRPPPPYPRPRPATSTPELASHRHKYVSGSSPD
LVTRKVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGTVNKRHSLEVMNSMVRGMEAM
TLKSLHLPMARRNTLREQGPPEEGPGSHEVPQLPQYHHKKTFSDATMLIHSTPESVPQIP
VLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQPGLPPGMARARVLRHGP
AKAISVSRTDPPAVNGASLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSIIEREM
MIRNLEKQKMAGLEAQKRPLMLAALNGLSVARVSGREENRVDATRVPMDERFRTLKKKLE
EGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNTGYINA
SHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSHRYWPK
LGSKHSSATYGKFKVTTKFRTDSVCYATTGLKVKHLLSGQERTVWHLQYTDWPDHGCPED
VQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVHCSAGVGRTGVLILSELMIYCLEHNE
KVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI
Download sequence
Identical sequences ENSPANP00000004656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]