SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004678 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004678
Domain Number 1 Region: 5-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.42e-50
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 404-450,527-620
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-19
Family Ankyrin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 300-333,379-429
Classification Level Classification E-value
Superfamily TPR-like 0.000038
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004678   Gene: ENSPANG00000011845   Transcript: ENSPANT00000006588
Sequence length 669
Comment pep:known_by_projection chromosome:PapAnu2.0:19:4566960:4568969:1 gene:ENSPANG00000011845 transcript:ENSPANT00000006588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRTAVYNAARDGKLQLLQKLLSGRSREELDELTGEVAGGGTPLLIAARYGHLDVVEYL
VDRCGASVEAGGSVHFDGETIEGAPPLWAASAAGHLDVVQSLLRRGASVNRTTRTNSTPL
RAACFDGHLEVVRYLVGEHQADLEVANRHGHTCLMISCYKGHREIARYLLEQGAQVNRRS
AKGNTALHDCAESGSLEILQLLLGCKARMERDGYGMTPLLAASVTGHTNIVEYLIQEQPG
QEQIAGGEAQPGLAQEGPSTSQGCAQPQGAPCCSSSPEEPLNGESYESCCPTSREAAVEA
LELLGATYVDKKRDLLGALKHWRRAMELRHQGGEYLPKPEPPQLVLAYDYSREVNTTEEL
EALITDPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFERCIRLWKYALDMQ
QTNLEPLSPMTASSFLSFAELFSYVLQDRATKGSLGTQIGFADLMGVLTKGVREVERALQ
LPREPGDSAQFTKALAIILHLLYLLEKVECTPSQEHLKHQTVYRLLKCAPRGKNGFTPLH
MAVDKDTTNVGRYPVGRFPSLHVVKVLLDCGADPDSRDFDNNTPLHIAAQNNCPAIMNAL
IEAGAHMDATNAFKKTAYELLDEKLLARGTMQPFNYVTLQCLAARALDKNKIPYKGFIPE
DLEAFIELH
Download sequence
Identical sequences ENSPANP00000004678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]