SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004705 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004705
Domain Number 1 Region: 148-217
Classification Level Classification E-value
Superfamily Homeodomain-like 2.35e-20
Family Homeodomain 0.0015
Further Details:      
 
Domain Number 2 Region: 56-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000353
Family LIM domain 0.009
Further Details:      
 
Domain Number 3 Region: 24-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000214
Family LIM domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004705
Domain Number - Region: 115-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0399
Family LIM domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004705   Gene: ENSPANG00000011378   Transcript: ENSPANT00000003263
Sequence length 390
Comment pep:known_by_projection chromosome:PapAnu2.0:1:183816001:183859650:-1 gene:ENSPANG00000011378 transcript:ENSPANT00000003263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQSATVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADC
QMQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIIC
NRQLATGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSP
KPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGGSKQ
EKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQ
DLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPT
SDISTGSSVGYPDFPTSPASWLDEMDHPPF
Download sequence
Identical sequences A0A096MXS7 A0A2K5P7Q5 A0A2K5TR95 A0A2K6DHK8 A0A2K6L2I8 A0A2K6RHB6 G7MF58
ENSPANP00000004705 XP_010373947.1.97406 XP_011744532.1.29376 XP_014978021.1.72884 XP_017744334.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]