SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004735 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004735
Domain Number 1 Region: 440-595,636-695
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.42e-27
Family Prokaryotic proteases 0.092
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004735
Domain Number - Region: 379-461
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0209
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004735   Gene: ENSPANG00000011446   Transcript: ENSPANT00000008753
Sequence length 732
Comment pep:known_by_projection chromosome:PapAnu2.0:14:14307366:14324382:-1 gene:ENSPANG00000011446 transcript:ENSPANT00000008753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSMKTEENKSFSATGDDQRTRPEVSEDTVMKRTCADTPVDHCLSGIRKCSSTFKPESEV
SKHETALEMQNPNLNNKECCFTFSLNENSRKLDRSVFTAYGKPSESIYSALSANDYFSER
MKNQFNKNIIVYEEKTIDGHINLGMPLKCLPSDSHFKITFHQRKSSEEDGHILRQCENPN
MECILFHVVAIGRTIKRIVKIKELHEKGSKLCIYALKGETIEGALCKDGRFRSDIGEFEW
KLKEGHKKIYGKQSMVDEVSGKVLEMDISKKKLQRKDIHKKIKQNENATDEVNHQSLIQP
KKKVHEPEKDGETKDGEHSREQILLPQDLSHYIKGETRQTIPRIRNYYIHSLIRKYWQIN
SQVRRRLHLGRQYAINLDVQKEATNLLKNFQMLNEAIMHHYPNFKEEAQWIRKYFQEEQK
RMDLSPSKQFKIYKKDFGKMTPNSIPVATCERLTYHSKSVGFMEWDNNGNTGNATCFVFN
GGYIFTCRHVVHLMAGENTHESLWPDIISKCAKVTFTYKEFCPTPDDWFSIEPWLLSNKT
LDYAILKLKENGNAFPPGLWRQISPQPSTGLIYLIGHPQGQTKGIDGCTVIPLNERFKKY
PNDCKDGLVDLHDTTSNVYAMFTQRSFLSEVWNTHTLSYDTCFSDGSSGSPVFNASGKLV
ALHTFGHFYQRGCNVHALIEYGYSIDSILCNIKETNESLYKLLNDEKLETYNEEKGKQES
LLQDHQIEPMEC
Download sequence
Identical sequences A0A096MXU8
ENSPANP00000004735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]