SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004737 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004737
Domain Number 1 Region: 223-348
Classification Level Classification E-value
Superfamily TPR-like 2.39e-47
Family Tetratricopeptide repeat (TPR) 0.000000315
Further Details:      
 
Domain Number 2 Region: 359-472
Classification Level Classification E-value
Superfamily TPR-like 1.67e-41
Family Tetratricopeptide repeat (TPR) 0.00062
Further Details:      
 
Domain Number 3 Region: 3-116
Classification Level Classification E-value
Superfamily TPR-like 3.37e-41
Family Tetratricopeptide repeat (TPR) 0.000000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004737   Gene: ENSPANG00000017079   Transcript: ENSPANT00000012309
Sequence length 543
Comment pep:known_by_projection chromosome:PapAnu2.0:14:9890005:9910388:-1 gene:ENSPANG00000017079 transcript:ENSPANT00000012309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQVNELKEKGNKALSAGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYED
GCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLA
ERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLS
VLLGVDLGSMDEEEEVATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKD
FDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIDVGRENREDYRQIA
KAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLA
LEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEEC
IQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHD
SPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLI
AIR
Download sequence
Identical sequences A0A096MXV0 A0A2K5KEN8 A0A2K5N0V2 H9FP55
XP_011798001.1.43180 XP_011897333.1.92194 XP_014969401.1.72884 ENSPANP00000004737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]