SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004785 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004785
Domain Number 1 Region: 71-373
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.17e-56
Family Asparaginyl hydroxylase-like 0.068
Further Details:      
 
Domain Number 2 Region: 1057-1289
Classification Level Classification E-value
Superfamily RNI-like 6.08e-30
Family Cyclin A/CDK2-associated p19, Skp2 0.022
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004785
Domain Number - Region: 627-676
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00094
Family variant PHD-like domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004785   Gene: ENSPANG00000010984   Transcript: ENSPANT00000014643
Sequence length 1312
Comment pep:known_by_projection chromosome:PapAnu2.0:11:120738418:120889162:-1 gene:ENSPANG00000010984 transcript:ENSPANT00000014643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPQMGGSAEDHPSRKRHAAEKQKKETIIYTKCYEFESATQRPIDRQRYDENEDLSDVE
EIVSVRGFSLEEKLRSQLYQGDFVHAMEGKDFNYEYVQREALRVPLIFREKDGLGIKMPD
PDFTVRDVKLLVGSRRLVDVMDVNTQKGTEMSMSQFVRYYETPEAQRDKLYNVISLEFSH
TKLEHLVKRPTVVDLVDWVDNMWPQHLKEKQTEATNAIAEMKYPKVKKYCLMSVKGCFTD
FHIDFGGTSVWYHVFRGGKIFWLIPPTLHNLALYEEWVLSGKQSDIFLGDRVERCQRIEL
KQGYTFFIPSGWIHAVYTPVDSLVFGGNILHSFNVPMQLRIYEIEDRTRVQPKFRYPFYY
EMCWYVLERYVYCVTQRSHLTLEYQRESMLIDAPRKPSIDGFSSDSWPPKPPTDGSASPT
SMPSEDQEALGKKPKAPALRFLKRTLSNESEESVKSTTLPVDYPKTPTGSPATEVSAKWT
HLTEFELKGLKALVEKLESLPENKKCVPEGIEDPQALLEGVKNVLKEHADDDPSLAITGV
PVVTWPKKTPKNRAVGRPKGKLGPASAVKLAANRTTAGARRRRTRCRKCEACLRTECGEC
HFCKDMKKFGGPGRMKQSCIMRQCIAPVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLME
CSICNEIIHPGCLKVSGPVGTGNKQTPTSQDSPLCNHAGKTGKAYKQKRGPGFKYASNLP
GSLLKEQKMNRDNKEGQEPAKRRSECEEAPRRRSDEHPKKVPPDGLLRRKSDDVHLRKKR
KYEKPQELSGRKRASSLQTSPGSSSHLSPRPPLGSSLSPWWRSSLTYFQQQLKPGKEDKL
FRKKRRSWKNAEDRMALANKPLRRFKQEPEDDLPEAPPKTRESDHSRSSSPTAGPSTEGT
EGPEEKKKVKMRRKRRLPNKELSRELSKELNHEIQRTESSLANENQQPIKSEPESEGEEP
KRPPGVCERPHRFSKGLNGTPRELRHQLGPGLRSPPRVISRPPPSVSPPKCIQMERHVIR
PPPISPPPDSLPLDDGAAHVMHREVWMAVFSYLSHQDLCVCMRVCRTWNRWCCDKRLWTR
IDLNHCKSITPLMLSGIIRRQPVSLDLSWTNISKKQLSWLINRLPGLRDLVLSGCSWIAV
SALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLD
ITDASLRLIIRHMPLLSKLHLSYCNHVTDQSINLLTAVGTTTRDSLTEINLSDCNKVTDQ
CLSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKLS
Download sequence
Identical sequences ENSPANP00000004785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]