SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004835 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004835
Domain Number 1 Region: 3-457
Classification Level Classification E-value
Superfamily TPR-like 1.2e-149
Family HAT/Suf repeat 0.0000000000000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004835   Gene: ENSPANG00000013722   Transcript: ENSPANT00000006137
Sequence length 625
Comment pep:known_by_projection chromosome:PapAnu2.0:14:31754521:31777947:1 gene:ENSPANG00000013722 transcript:ENSPANT00000006137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLHIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKG
VEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDRSRD
YMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVDMWKKYIQWEKSNPLRTEDQTLI
TKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAI
STLLKKNMLLYFAYADYEESRMKYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIK
SGRMIFKKAREDTRTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYID
YLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRFTAF
KEEYEGKETALLVDRYKFMDLYPCSASELKALGYKDVSRAKLAAIIPDPVVAPSIVPVLK
DEVDRKPEYPKPDTQQMIPFQPRHLAPPGLHPVPGGVFPVPPAAVVLMKLLPPPICFQGP
FVQVDELMEIFRRCKIPNTVEEAVRIITGGAPELAVEGNGPVESNAVLTKAVKRPNEDSD
EDEEKGAVVPPVHDIYRARQQKRIR
Download sequence
Identical sequences A0A2K5C978 A0A2K5J5R4 A0A2K5KLW5 A0A2K5QEA4 A0A2K5UN97 A0A2K5ZSW9 A0A2K6B0C0 A0A2K6N1N8 A0A2K6RHD7 A0A2K6T9G1 G1S8B3
ENSSTOP00000011937 XP_011791758.1.43180 XP_012001500.1.54773 XP_014969983.1.72884 XP_017705186.1.44346 XP_017833485.1.60252 XP_019803603.1.83887 ENSSTOP00000011937 ENSPANP00000004835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]