SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004852 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004852
Domain Number 1 Region: 140-266
Classification Level Classification E-value
Superfamily PX domain 1.57e-31
Family PX domain 0.001
Further Details:      
 
Domain Number 2 Region: 303-430,457-519
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000349
Family BAR domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004852   Gene: ENSPANG00000011931   Transcript: ENSPANT00000009608
Sequence length 523
Comment pep:known_by_projection chromosome:PapAnu2.0:6:116607252:116661087:1 gene:ENSPANG00000011931 transcript:ENSPANT00000009608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEREPPPLGDGKPTDFEDLEDGEDLFTSTVSTLESSPSSPEPASLPAEEISANSNGPK
PTEVGLDDDREDLFAEATEEVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSA
PVIFDRSREEIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSV
KRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALE
RYLQRTVKHPTLLQDPDLRQFLESSELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMN
ESDAWFEEKQQQFENLDQQLRKLHASVEALVCHRKELSANTAAFAKSAAMLGNSEDHTAL
SRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDA
QITLLKKREAEAKMMVANKPDKIQQAKNEIREEIEEWEAKVQQGERDFEQISKTIRKEVG
RFEKERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA
Download sequence
Identical sequences ENSPANP00000004852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]