SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004855 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004855
Domain Number 1 Region: 136-472
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.45e-87
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000323
Further Details:      
 
Domain Number 2 Region: 38-121
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000184
Family Anticodon-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004855   Gene: ENSPANG00000025887   Transcript: ENSPANT00000029270
Sequence length 477
Comment pep:known_by_projection chromosome:PapAnu2.0:14:68299606:68437591:-1 gene:ENSPANG00000025887 transcript:ENSPANT00000029270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGVRCLLRSVRFCSSAPFPRHKPSAKLSVRDALGAQNTSGEHIKVQGWIRSVRSQKKVL
FLHVNDGSSLESLQVVADSSLDSRELTFGSSVEIQGQLIKSPSKGQNVELKAEKIKIVGN
CDAKAFPIKYKERHPLEYLRQYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHT
PIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGP
TFRAENSQSRRHLAEFYMVEAEISFVNSLQDLMQVIEELFKATTMMVLSHCPEDVELCHK
FIAPGQKDILEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGINLQTEHEKYLVKHCG
NIPVFIINYPLAIKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLA
RSGLTEVYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL
Download sequence
Identical sequences A0A096MY56
ENSPANP00000004855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]