SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004868 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004868
Domain Number 1 Region: 163-238
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.5e-25
Family PHD domain 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004868   Gene: ENSPANG00000023377   Transcript: ENSPANT00000026515
Sequence length 240
Comment pep:known_by_projection chromosome:PapAnu2.0:12:103483267:103506024:1 gene:ENSPANG00000023377 transcript:ENSPANT00000026515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQ
RVERLQKIQNAYSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKMEGSDF
ESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKKHKGGSEFTDTILSVHPSDVLDMP
VDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK
Download sequence
Identical sequences A0A096MY69 A0A0D9R0C2 A0A2I3TFD1 A0A2J8RPT0 A0A2K5V8Z5 H9G0P4 Q8WYH8
ENSMMUP00000018533 NP_001180930.1.72884 NP_115705.2.87134 NP_115705.2.92137 XP_005574953.1.63531 XP_007965196.1.81039 XP_516211.2.37143 ENSPANP00000004868 9598.ENSPTRP00000041067 9606.ENSP00000322142 ENSPTRP00000041067 ENSP00000322142 ENSPTRP00000041067 gi|18644730|ref|NP_115705.2| GO.56869 HR5334 ENSP00000322142 ENSP00000322142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]