SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004876 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004876
Domain Number 1 Region: 69-135
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 8.59e-16
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 2 Region: 164-228
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000277
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 3 Region: 260-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000943
Family EGF-type module 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004876   Gene: ENSPANG00000017694   Transcript: ENSPANT00000016761
Sequence length 374
Comment pep:known_by_projection chromosome:PapAnu2.0:12:53718921:53960589:-1 gene:ENSPANG00000017694 transcript:ENSPANT00000016761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVARPVKLAAFPTSLSDCQTPTGWNCSGYD
DRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAA
CKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWC
VCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDG
HYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHC
EKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNRIHRQKQNTGH
YSSDNTTRASTRLI
Download sequence
Identical sequences A0A096MY77 A0A0D9RHX9 A0A2I3TTZ1 A0A2K5HA65 A0A2K5SJA5 A0A2K5YI79 A0A2K6DIW8 A0A2K6ULT4 G7N8J3 G7PL27 Q9UIK5
NP_057276.2.87134 NP_057276.2.92137 XP_001084859.2.72884 XP_003825339.1.60992 XP_003940856.1.74449 XP_005573850.1.63531 XP_007963890.1.81039 XP_011716536.1.29376 XP_011791807.1.43180 XP_011829596.1.47321 XP_017356152.1.71028 XP_515997.2.37143 ENSP00000272771 ENSPANP00000004876 ENSPTRP00000057659 9598.ENSPTRP00000057659 9606.ENSP00000272771 ENSPTRP00000057659 gi|12383051|ref|NP_057276.2| ENSP00000376128 ENSP00000272771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]