SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004893 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004893
Domain Number 1 Region: 102-191
Classification Level Classification E-value
Superfamily GTF2I-like repeat 5.62e-33
Family GTF2I-like repeat 0.00095
Further Details:      
 
Domain Number 2 Region: 326-412
Classification Level Classification E-value
Superfamily GTF2I-like repeat 1.14e-30
Family GTF2I-like repeat 0.001
Further Details:      
 
Domain Number 3 Region: 538-938
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000129
Family Hermes transposase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004893   Gene: ENSPANG00000018076   Transcript: ENSPANT00000027945
Sequence length 948
Comment pep:novel chromosome:PapAnu2.0:3:45859783:45899017:-1 gene:ENSPANG00000018076 transcript:ENSPANT00000027945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQVAVSTLPVEEESSSESRMVVTFLVSALESMCKELAKSKAEVACIAVYETDVFVVGTE
RGCAFVNARTDFQKDFAKYCIAEGLREVKPPCPVNGMQVHSGETEILRKAVEDYFCFCYG
KALGTTVMVPVPYEKMLRDQSAVAVQGLPEGVAFQHPENYNLETLKWILENKAGISFIIN
RPFLGPESQLGGPGMVTDAERSTVSPNESCGPISVKTEPMEDSGGYHDAFRIKNRYFSLC
SILFIFLSGSHPSSTSNEVIEMELPMEDSTPLVPSEEPNEDPEAEVKIEGNTNSSSVTNS
AAGVEDLNIVQVTVPDNEKERLSSIEKIKQLREQVNDLFSRKFGEAIGVDFPVKVPYRKI
TFNPGCVVIDGMPPGVVFKAPGYLEISSMRRILEAAEFIKFTVIRPLPGLELSNVGKRKI
DQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYTERM
RDEKLHELKKGLRKYLLGSSDTECPEQKQVLANASPTQKSPVQPVEDLAGNLWEKLREKI
RSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFSRVEK
SLKKFCIDWSKLVSVASTGTPAMVDANNGLVTKLKSRVATFCKGAELKSLCCIIHPESLC
AQKLKMDHVMDVVVNSVNWICSRGLNHSEFTTLLYELDSQYGSLLYYTEIKWLSRGLVLK
RFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNTLNISLQGHSQIVTQMY
DLIRAFLAKLCLWETHLARNNLAHFPTLKSVSRNESDGLNYIPKIAELKAEFQKRLSDFK
LYESELAVFSSPFSMKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLWGSYPKY
KHHCAKVLSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLHITT
Download sequence
Identical sequences ENSPANP00000004893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]