SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004914 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004914
Domain Number 1 Region: 991-1043
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000184
Family PHD domain 0.0024
Further Details:      
 
Domain Number 2 Region: 63-116
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000199
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004914   Gene: ENSPANG00000020014   Transcript: ENSPANT00000018586
Sequence length 1171
Comment pep:known_by_projection chromosome:PapAnu2.0:14:56306121:56337908:1 gene:ENSPANG00000020014 transcript:ENSPANT00000018586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARNCSECKEKRAAHILCTYCNRWLCSSCTEEHRHSPVSGGPFFPRAQKGSLGVNSGPGD
FTLYCPLHTQEVLKLFCETCDMLTCHSCLMVEHKEHRCRHVEEVLQNQRMLLESVTTQVA
HKKSSLQTSAKQIEDRIFEVKHQHRKVENQIKMAKMVLMNELNKQANGLIEELEGITNER
KRKLEQQLQSIMVLNRQFEHVQNFINWAVCSKTSVPFLFSKELIVFQMQRLLETSCNTDP
GSPWSIRFTWEPNFWTKQLASLGCITTEGGQLSRADASAYGGLQGPSPFYQSHQSPVAQQ
EALSHPSHKFQSPAVCSSSVCCSHCSPVSPSLKGQGPPPSMHPAHNFRQPSEMVPQQLGS
LQCSALLPREKELACSPHPPKLLQPWLETQPPVEQESTSQRLGQQLTSQPVCIVPPQDVQ
QGTHAQPTLQTPSIQDQFGHNQKLKLSHFQQQPQQQLPPPPPPLPAPPQQPHPPLPPSQH
LASSQHQSTPGPACSQNVDIMHHKFELEEMQKDLELLLQAQQPSLQLSQTKSPQHLQQTI
VGQINYIVRQPAPVQSQSQEETLQGTDEPPASEGSKRALSLDKNTAAALPQASGEETPLG
VPPVDSTIQHSSPNVVRKHSTSVSIMGFSNTLEMELSSTRLERPLEPQIQSVSSLTSGAP
LAVPSLLSASPKTVSSLTSVQNQAMPSLTTSHLQTVPSLVRSTFQSVPNLMSDSSQAMAS
LASDHPQAGPSLMSGHTQAVPSLATCPLQSIPPVSDMQPETGSSSSSGRTSGSLCPGDGA
DSSLGNALCKMESEDSTCFTDSLGQGPIAPGLDASKDLTIPSELEEPINLSVKKPPLAPV
VSTSTALQQYRNPKECENFEQGALELDAKENKSIRAFNSEHKIPYVRLERLKICAASSGE
MPVFKLKPQKNDQDGSFLLIIECGTESSSMSIKVSQDRLSEATQAPGLGGRKVTVTSLAG
QRPSEVEGTSPEEHRLIPRTPGAKKGPPAPIENEDFCAVCLNGGELLCCDHCPKVFHLSC
HVPALLSFPGGEWVCTLCRSLTQPEMEYDCENARYNQPGMRASPGLSMYDQKVGRSLWKQ
GSLPLAAPFCLQGLRAFRGDEGLFWIPFFVLCLTTWPRGVWMIFLLPAVFLWLGNLNYTL
VWRLAPCGTEPGSYQGQHLFCFVLFFLFFVF
Download sequence
Identical sequences ENSPANP00000004914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]