SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004962 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004962
Domain Number 1 Region: 535-564,662-741
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000647
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004962   Gene: ENSPANG00000020587   Transcript: ENSPANT00000007047
Sequence length 758
Comment pep:known_by_projection chromosome:PapAnu2.0:2:86689941:86699286:1 gene:ENSPANG00000020587 transcript:ENSPANT00000007047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLADASGPRDTQALLSATQAVELRRRDYHMERPLLNQEHLEELGRWGSAPRTRQWRTWL
QCSHARARALLLQHLPVLVWLPRYPVRDWLLGDLLSGMSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLAPQTLNDSTINETTRDAER
VRVASTLSVLVGLFQVGLGLIHFGFLVTYLSEPLVRGYTTAAAVQVFVSQLKYVFGLHLS
SHSGPLSLIYTVLEVCQKLPQSKVSTVVTAAVAGVVLLVVKLLNDKLQRQLPMPIPGELL
MLIGATGISYGMGLKHIFGVDVVGNISAGLVPPVAPNTQLFSKLVGSAFTIAVVGFAIAI
SLGKIFALRHGYRVDSNQELVALGLSNLVGGIFQCFPVSCSMSRSLVQESTGGNSQVAGA
ISSLFILLIIVKLGELFRDLPKAVLAAIIIVNLKGMLRQLSDVCSLWKANRADLLIWLVT
FAATILLNLDLGLMVSVVFSLLLVVVRTQMPHYSILGQVPNTDIYRDVAEYSEAKEVPGV
KVFRSSATVYFANADFYSDALKQRCGVDVDFLISQKKKLLKKREQLKLKQLQKEKKLQKQ
AASSKGASVSINVNTSLEDMRSNNVEDCKVMVSPGDKMEDATANGQEDSKAPDGSTLKAL
GLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFREIEVEVYMAACHSPVVSQLEVGHF
FDASITKKHLFASVHDAVTFALQHPRPVPDSPVSVTRL
Download sequence
Identical sequences ENSPANP00000004962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]