SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004974 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004974
Domain Number 1 Region: 273-341
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000243
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 2 Region: 57-80
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000085
Family CCCH zinc finger 0.0044
Further Details:      
 
Domain Number 3 Region: 87-109
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000116
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number 4 Region: 208-233
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000412
Family CCCH zinc finger 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004974
Domain Number - Region: 369-398
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00157
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004974   Gene: ENSPANG00000017280   Transcript: ENSPANT00000007519
Sequence length 486
Comment pep:known_by_projection chromosome:PapAnu2.0:3:162251563:162271813:-1 gene:ENSPANG00000017280 transcript:ENSPANT00000007519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAAPGTTATTSGAGAAAAAAAAASPTPIPTVTAPSLGAGGGGGGSDGSGGGWTKQVT
CRYFMHGVCKEGDNCRYSHDLSDSPYSVVCKYFQRGYCIYGDRCRYEHSKPLKQEEATAT
ELTTKSSLAAPSSLSSIVGPLVEMNTGEAESRNSNFATVGAGSEDWVNAIEFVPGQPYCG
RTAPSCTEAPLQGSVTKEESEKEQTAVETKKQLCPYAAVGECRYGENCVYLHGDSCDMCG
LQVLHPMDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFG
ILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIIHSQPSEYWVEEKEEKQK
LILKYKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRR
NHFWELIEERENSNPFDNDEEEVVTFELGEMLLMLLAAGGDDDLTDSEDEWDLFHDELED
FYDLDL
Download sequence
Identical sequences ENSPANP00000004974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]