SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005005 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005005
Domain Number 1 Region: 273-542
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.26e-81
Family Protein kinases, catalytic subunit 0.000000000324
Further Details:      
 
Domain Number 2 Region: 160-304
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-40
Family SH2 domain 0.00000613
Further Details:      
 
Domain Number 3 Region: 89-211
Classification Level Classification E-value
Superfamily SH3-domain 1.06e-26
Family SH3-domain 0.0000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005005   Gene: ENSPANG00000005606   Transcript: ENSPANT00000001083
Sequence length 550
Comment pep:known_by_projection chromosome:PapAnu2.0:18:12441029:12479790:1 gene:ENSPANG00000005606 transcript:ENSPANT00000001083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFENLIMGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTASPCPSSSAKGTAVN
FSSLSMTPFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFK
KGERFQIINNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLL
NPGNQRGIFLVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFDTL
QKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWM
GTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSK
GSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIA
DFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPY
PGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTAT
EPQYQPGENL
Download sequence
Identical sequences A0A096MYI8 A0A1D5RAI3
ENSPANP00000005005 XP_007972691.1.81039 XP_011710966.1.29376 XP_011911586.1.92194 XP_014977079.1.72884 XP_014977080.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]