SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005008 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005008
Domain Number 1 Region: 13-91
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1e-30
Family eIF5a N-terminal domain-like 0.00023
Further Details:      
 
Domain Number 2 Region: 84-151
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.17e-23
Family Cold shock DNA-binding domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005008   Gene: ENSPANG00000012399   Transcript: ENSPANT00000021447
Sequence length 153
Comment pep:known_by_projection chromosome:PapAnu2.0:2:114854054:114869687:1 gene:ENSPANG00000012399 transcript:ENSPANT00000021447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVG
IDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELG
KEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
Download sequence
Identical sequences A0A091DFG0 A0A0D9RJW0 A0A1D5Q4L3 A0A1S3F4U7 A0A212CIB5 A0A250YAE9 A0A287B4A3 A0A2I2YC22 A0A2I3MV74 A0A2J8TIR3 A0A2K5CAS9 A0A2K5HLG3 A0A2K5KY26 A0A2K5Q754 A0A2K5V384 A0A2K5YRW1 A0A2K6EAK9 A0A2K6FTR9 A0A2K6N624 A0A2K6R7R5 A0A2K6SIP2 F1MN49 F6YNW2 G1LDN0 G1QZM2 G1TC37 G3I948 G3V7J7 G5BT60 H2QNQ9 I3MB27 J9NXY1 L7N1R9 M3W8Z1 M3Z095 Q5R898 Q8BGY2 Q9GZV4 S7NS21 U6CPK7
10090.ENSMUSP00000050289 10116.ENSRNOP00000015779 9544.ENSMMUP00000030130 9598.ENSPTRP00000026874 9600.ENSPPYP00000015978 9606.ENSP00000295822 9986.ENSOCUP00000014319 Hs9966867___KOG3271 ENSPTRP00000026874 ENSAMEP00000005012 ENSMUSP00000050289 NP_001094167.1.100692 NP_001094167.1.4139 NP_001127495.1.23681 NP_001179018.1.59421 NP_001179018.1.76553 NP_001247868.1.72884 NP_065123.1.87134 NP_065123.1.92137 NP_808254.1.92730 XP_002716470.1.1745 XP_002759432.1.60252 XP_003511586.1.69978 XP_003831974.1.60992 XP_003924998.1.74449 XP_003991966.1.62641 XP_004393291.1.74151 XP_004447977.1.11602 XP_004447978.1.11602 XP_004633513.1.9945 XP_004652407.1.11716 XP_004675017.1.23501 XP_004756626.1.14098 XP_004834647.1.39548 XP_004834648.1.39548 XP_005332535.1.77405 XP_005371740.1.66349 XP_005546425.1.63531 XP_005639970.1.84170 XP_005886637.1.60319 XP_005891796.1.15283 XP_006055372.1.26621 XP_006088904.1.53796 XP_006232293.1.100692 XP_006736402.1.47382 XP_006764166.1.95426 XP_006861892.1.41390 XP_006910892.1.64745 XP_006971227.1.50099 XP_007077139.1.5354 XP_007077140.1.5354 XP_007629363.1.28591 XP_007944811.1.48129 XP_007970300.1.81039 XP_008140514.1.99482 XP_008586349.1.73410 XP_008703559.1.72690 XP_008828327.1.79516 XP_008981710.1.60252 XP_009237801.1.23681 XP_010333973.1.74449 XP_010362351.1.97406 XP_010630692.1.5607 XP_010630693.1.5607 XP_010833541.1.44457 XP_011378675.1.92234 XP_011712680.1.29376 XP_011804380.1.43180 XP_011853696.1.47321 XP_011853697.1.47321 XP_011916084.1.92194 XP_012322131.1.9421 XP_012495645.1.63892 XP_012591847.1.48125 XP_012871626.1.60039 XP_013368879.1.28644 XP_014311441.1.53796 XP_014389099.1.60319 XP_014389100.1.60319 XP_014944042.1.86478 XP_014944043.1.86478 XP_015349759.1.40921 XP_015983030.1.101085 XP_015983031.1.101085 XP_016058466.1.3490 XP_016795677.1.37143 XP_017385364.1.71028 XP_017385366.1.71028 XP_017510099.1.32401 XP_017707069.1.44346 XP_017707070.1.44346 XP_018878436.1.27298 XP_019318699.1.44245 XP_019499454.1.44202 XP_019590837.1.88060 XP_019815230.1.53367 XP_020043221.1.5219 XP_020754495.1.74333 XP_020754496.1.74333 XP_020925457.1.46622 XP_020925458.1.46622 XP_021052423.1.100879 XP_021065531.1.100879 XP_021487631.1.76796 XP_021558321.1.83697 XP_021586831.1.77405 ENSAMEP00000005012 ENSCJAP00000004408 ENSCJAP00000004413 ENSPPYP00000015978 ENSCJAP00000004408 ENSRNOP00000015779 ENSSTOP00000007276 ENSMLUP00000014025 ENSP00000295822 ENSMPUP00000017006 ENSPTRP00000026874 ENSSTOP00000007276 ENSPPYP00000015978 ENSPVAP00000011831 ENSBTAP00000013947 ENSFCAP00000007506 ENSDORP00000013923 ENSPVAP00000011831 ENSNLEP00000006393 ENSMMUP00000030130 ENSMUSP00000050289 ENSNLEP00000006393 ENSCAFP00000038148 ENSMLUP00000014025 ENSOCUP00000014319 ENSMPUP00000017006 ENSMUSP00000050289 ENSBTAP00000013947 ENSOCUP00000014319 ENSPANP00000005008 ENSRNOP00000015779 ENSP00000295822 ENSP00000295822 HGL_H00000295822-2 ENSDORP00000013923 ENSCAFP00000038148 gi|9966867|ref|NP_065123.1| ENSMMUP00000030130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]