SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005020 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005020
Domain Number 1 Region: 446-555
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.53e-30
Family PDI-like 0.01
Further Details:      
 
Domain Number 2 Region: 121-233
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.61e-28
Family PDI-like 0.014
Further Details:      
 
Domain Number 3 Region: 669-779
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.57e-28
Family PDI-like 0.036
Further Details:      
 
Domain Number 4 Region: 33-125
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.06e-26
Family Chaperone J-domain 0.00022
Further Details:      
 
Domain Number 5 Region: 553-653
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.85e-25
Family PDI-like 0.024
Further Details:      
 
Domain Number 6 Region: 349-462
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000079
Family PDI-like 0.042
Further Details:      
 
Domain Number 7 Region: 234-345
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000115
Family PDI-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005020   Gene: ENSPANG00000012554   Transcript: ENSPANT00000016331
Sequence length 793
Comment pep:known_by_projection chromosome:PapAnu2.0:12:44596109:44648391:1 gene:ENSPANG00000012554 transcript:ENSPANT00000016331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVWLNKDDYIRDLKRIILCFLIVYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLAL
KLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWNYYRY
DFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEVDGLLR
IGAVNCGDDRMLCRMKGVNSYPSLLIFRSGMAPVKYHGDRSKESLVSFAMQHVRSTVTEL
WTGNFVNSIQTAFAAGIGWLITFCSKGGDCLTSQTRLRLSGMLDGLVNVGWMDCATQDNL
CKSLDITTSTTAYFPPGATLNNREKNSILFLNSLDAKEIYLEVIHNLPDFELLSANTLED
RLAHHRWLLFFHFGKNENSNDHELKKLKTLLKNDHIQVGRFDCSSAPDICSNLYVFQPSL
AVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPANDKEPWLVDFFAPWC
PPCRALLPELRRASNLLYGQLKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGH
HSAEQILEFIEDLMNPSVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKR
MARTLTGLINVGSIDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYQYHSYNGWNRDAYSL
RIWGLGFLPQVSTDLTPQTFSEKVLQGKNHWVIDFYAPWCGPCQNFAPEFELLARMIKGK
VKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALINEKLE
TLQNQGKRNKDEL
Download sequence
Identical sequences A0A096MYK3
ENSPANP00000005020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]