SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005028 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000005028
Domain Number - Region: 44-137
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 0.00847
Family Glycerophosphoryl diester phosphodiesterase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005028   Gene: ENSPANG00000006073   Transcript: ENSPANT00000015416
Sequence length 277
Comment pep:known_by_projection chromosome:PapAnu2.0:6:74527132:74561063:1 gene:ENSPANG00000006073 transcript:ENSPANT00000015416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHVNTVILGSWSENILEYFLRNSQITAEDGAEITWYHAANHKAQMNEALKSTAHMIEADV
LLPSDGSEHSQPIMAHPPETNSDNTLQEWLTEVTKSNKGIKLDFKSLAAVEPSMMLLENV
KRHLKRPVWINADILPGPNGNSKVIDAKPFLDTVTFFFPDVTFSLGWTTGWHPEKVNEEG
YSWTMVKEMEYICNELSQPVTFPVRAALVRQSCSQLLWLLKQSSRYSLTIWTGKNDNYSI
EDLLYIRDHFDKKQVFYDILEPQNHEFKQAIGIKVNL
Download sequence
Identical sequences ENSPANP00000005028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]