SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005036 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005036
Domain Number 1 Region: 530-745
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-104
Family Thrombospondin C-terminal domain 0.000000089
Further Details:      
 
Domain Number 2 Region: 407-528
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.26e-35
Family TSP type-3 repeat 0.00000345
Further Details:      
 
Domain Number 3 Region: 28-72
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 1.96e-16
Family Assembly domain of cartilage oligomeric matrix protein 0.00014
Further Details:      
 
Domain Number 4 Region: 338-409
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000536
Family TSP type-3 repeat 0.00019
Further Details:      
 
Domain Number 5 Region: 268-350
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000017
Family TSP type-3 repeat 0.00015
Further Details:      
 
Domain Number 6 Region: 121-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000185
Family EGF-type module 0.027
Further Details:      
 
Domain Number 7 Region: 174-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005036
Domain Number - Region: 229-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family EGF-like domain of nidogen-1 0.071
Further Details:      
 
Domain Number - Region: 91-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0911
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005036   Gene: ENSPANG00000004388   Transcript: ENSPANT00000027697
Sequence length 758
Comment pep:known_by_projection chromosome:PapAnu2.0:19:17341534:17349867:-1 gene:ENSPANG00000004388 transcript:ENSPANT00000027697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPDTACVLLLTLAALGASGQSQIPLGSDLGPQMLRELQETNAALQDVRELLRQQVREIT
FLKNTVMECDACAGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFT
GNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHEGVGLAFAKANKQVCT
DINECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQESGCQRRAQRFCPDGSPSECHE
HADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSG
QEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRTQKNDDQ
KDTDQDGRGDACDDDIDGDRIRNQADNCPRIPNSDQKDSDGDGIGDACDNCPQKSNPDQG
DVDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQQDSDHDGQGDACDNDDDNDGVPD
SRDNCRLVPNPGQEDADRDGVGDVCQGDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVL
DPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGF
IFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGD
TDSQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRG
GRLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRRA
Download sequence
Identical sequences ENSPANP00000005036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]