SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005048 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005048
Domain Number 1 Region: 107-277
Classification Level Classification E-value
Superfamily TPR-like 1.82e-18
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005048   Gene: ENSPANG00000017054   Transcript: ENSPANT00000015682
Sequence length 329
Comment pep:known_by_projection chromosome:PapAnu2.0:8:103424317:103474157:1 gene:ENSPANG00000017054 transcript:ENSPANT00000015682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKSNVTLHRPVERHVTASPRPLTPLLLGSGKMAKVSELYDVTWEEMRDKMRKWREENSR
NSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSHR
VKRLTGMRFEAMERYDDAVQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYL
EQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENL
ELSRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMKYASWAASQINRAY
QFAGRSKKETKYSLKAVEDMLETLQITQS
Download sequence
Identical sequences A0A2K5WQY5 A0A2K6DEM2
XP_011729829.1.29376 ENSPANP00000005048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]