SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005052 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005052
Domain Number 1 Region: 47-195
Classification Level Classification E-value
Superfamily EF-hand 3.83e-17
Family Calmodulin-like 0.0000771
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005052   Gene: ENSPANG00000005181   Transcript: ENSPANT00000010406
Sequence length 196
Comment pep:known_by_projection chromosome:PapAnu2.0:12:72178614:72202065:-1 gene:ENSPANG00000005181 transcript:ENSPANT00000010406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKDVKKPAAAAAPAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKQQQDEFKEAFL
LFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEVKNVSRNRAQFIPDCEIIS
NVKFKSNFINFLNYLKFKEREGPPKAGDKGGICTKESFVSSGEKMKEEEVEALMAGQEDS
NGCINYEAFVKHIMSI
Download sequence
Identical sequences ENSPANP00000005052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]