SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005057 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005057
Domain Number 1 Region: 53-176
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000733
Family Spermadhesin, CUB domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005057   Gene: ENSPANG00000010788   Transcript: ENSPANT00000024744
Sequence length 322
Comment pep:known_by_projection chromosome:PapAnu2.0:6:71025940:71042975:1 gene:ENSPANG00000010788 transcript:ENSPANT00000024744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRC
LDMLSLQGQFTFTADRPQLHCAAFFIGEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKG
EKFPSSQDHPLPTAERYIDFCETGLSRRSIRSSQNVAMIFFRVREPGNGFTLTIKTDPNL
FPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGI
GDFVELLGGTGLDPSKMIPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHINRVTFEYRQ
LEPYELENPNGNSIGEFCLSDL
Download sequence
Identical sequences A0A096MYN7 A0A2K5LZR7 A0A2K5YUN1 A0A2K6D7J0 F7DGB5
ENSMMUP00000028130 ENSPANP00000005057 ENSMMUP00000028130 NP_001244382.1.72884 XP_011728422.1.29376 XP_011851726.1.47321 XP_011944641.1.92194 9544.ENSMMUP00000028130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]