SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005061 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005061
Domain Number 1 Region: 109-139
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000864
Family PHD domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005061
Domain Number - Region: 230-294
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.0484
Family RecG, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005061   Gene: ENSPANG00000009973   Transcript: ENSPANT00000009570
Sequence length 331
Comment pep:known_by_projection chromosome:PapAnu2.0:17:27805370:27833928:1 gene:ENSPANG00000009973 transcript:ENSPANT00000009570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQASPLGPKRVDGAGSPEAQPAQEALFLPTGVFQVAEKMEKRTCALCPKDVEYNVLYFA
QSENIAAHENCLLYSSGLVECEDHDPLNLDRSFDVESVKKEIQRGRKLKCKFCHKRGATV
GCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPNSAQSAKFSGVKRKRGR
KKHLSGNHIQSPETMKCNTFVRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDK
VHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRRQQLKEEI
ELLQDLKQTLCSFQENRDLMSSSTSVSSLSY
Download sequence
Identical sequences A0A096MYP1 A0A2K5MDY9
ENSPANP00000005061 XP_011919648.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]