SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005071 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005071
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily PX domain 9.16e-21
Family PX domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005071   Gene: ENSPANG00000018545   Transcript: ENSPANT00000006248
Sequence length 440
Comment pep:known_by_projection chromosome:PapAnu2.0:8:95855999:95926139:-1 gene:ENSPANG00000018545 transcript:ENSPANT00000006248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMHFCIPVSQQRSDALGGRYVLYSVYLDGFLFCRLRYSQLHDWNEQLRRVFGNCLPPFP
PKYYLAMTTAMADERRNQLEQYLQNVTMDPNVLRSDVFVEFLKLAQLNTFDITPKKAYLD
IFLPNEESIKIEIITSDTAERVLEVASHKIGLCRELLGYFGLFLIRFGKEGKLSVVKKLA
DFELPYVSLGSSEVENCKVGLRKWYMDPSLDSTLMDCRAALDLLYMQAIQDIEKEWAKPT
QAQRQKLEAFQKEDNQTKFLELAREVQHYGYLQLDPCTCDYPEPGSGAVLSVGNNEISCC
ITLPGSQTQDVIFQMSRVKCWQVTFLGTLLDMDGPQRTLNQNLELRFQYSEDSCWQWFVI
YTKQAFLLSSCLKKMISEKMVKLAAKNPEMQIEVPEQSKSKKYHIQQSQQKDYSSFLSRK
SKIKTAKDDCVFGNIKEEDL
Download sequence
Identical sequences A0A096MYQ1
ENSPANP00000005071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]