SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005084 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005084
Domain Number 1 Region: 57-259
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.88e-72
Family alpha-catenin/vinculin 0.00000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005084   Gene: ENSPANG00000024102   Transcript: ENSPANT00000009826
Sequence length 354
Comment pep:known_by_projection chromosome:PapAnu2.0:13:78293488:78713676:1 gene:ENSPANG00000024102 transcript:ENSPANT00000009826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNIL
Download sequence
Identical sequences A0A1D5R621
XP_012598172.1.48125 XP_020141811.1.48125 XP_020770915.1.74333 XP_020770916.1.74333 XP_020770917.1.74333 ENSPANP00000005084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]