SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005089 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005089
Domain Number 1 Region: 410-773
Classification Level Classification E-value
Superfamily SIS domain 9.28e-103
Family double-SIS domain 0.000000393
Further Details:      
 
Domain Number 2 Region: 96-304,341-385
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.4e-50
Family Class II glutamine amidotransferases 0.0000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005089   Gene: ENSPANG00000006255   Transcript: ENSPANT00000023617
Sequence length 773
Comment pep:known_by_projection chromosome:PapAnu2.0:13:68217037:68280164:-1 gene:ENSPANG00000006255 transcript:ENSPANT00000023617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPTGGGALRAEGRGLAAVAGGAWEVEKAVVALAIASPRESCRRHPGPRARRLPTEARVC
TPDSASHSPLASRAVSPASCVNFTAEETGIEEIKSIFAYLNYHVPRTRREILETLIKGLQ
RLEYRGYDSAGVGFDGGNDKDWEANACKIQLIKKKGKVKALDEEVHKQQDMDLDIEFDVH
LGIAHTRWATHGEPNPVNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKGYDFESETD
TETIAKLVKYMYDNQESQDTSFTTLVERVIQQLEGAFALVFKSVHFPGQAVGTRRGSPLL
IGVRSEHKLSTDHIPVLYRTGKDKKGSCNLSRVDSTTCLFPVEEKAVEYYFASDASAVIE
YTNRVIFLEDDDVAAVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKE
IFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVL
EELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITN
TVGSSISRETDCGVHINAGPEVGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIML
GLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSE
GILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETI
KNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences ENSPANP00000005089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]