SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005115 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000005115
Domain Number - Region: 72-138
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00107
Family Apolipoprotein A-I 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005115   Gene: ENSPANG00000001632   Transcript: ENSPANT00000017888
Sequence length 218
Comment pep:known_by_projection chromosome:PapAnu2.0:19:11674547:11692822:-1 gene:ENSPANG00000001632 transcript:ENSPANT00000017888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERQGVDVPHVKCKDQEPQPLGESKEHQRWEENCKEEAGGGPASASCQLTVLEGKSGLYF
SSLDSSIDILQKRAQELIENINQSRQKDHALMTNFRNSLKTKVSDLTEKLEERIYQIYND
HNKIIQEKLQEFTQKMAKISHLETELKQVCHSVETVYKDLCLQPEQSLRLRRGPDHSRGK
SPPRPSDSQPPDVFVSSVAETTSQATASEEQTHRDGEC
Download sequence
Identical sequences A0A0A0MV52 A0A2K5NK71 A0A2K5ZV87
ENSPANP00000005115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]