SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005151 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005151
Domain Number 1 Region: 297-616
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.8e-88
Family p120GAP domain-like 0.0000787
Further Details:      
 
Domain Number 2 Region: 577-714
Classification Level Classification E-value
Superfamily PH domain-like 2.2e-47
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 3 Region: 146-307
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.87e-26
Family Synaptotagmin-like (S variant) 0.039
Further Details:      
 
Domain Number 4 Region: 20-133
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.83e-23
Family Synaptotagmin-like (S variant) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005151   Gene: ENSPANG00000013357   Transcript: ENSPANT00000000916
Sequence length 835
Comment pep:known_by_projection chromosome:PapAnu2.0:17:90584750:90672451:-1 gene:ENSPANG00000013357 transcript:ENSPANT00000000916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVCDEQGTRRFHAADDFLGEAKNLPSYPGPSKMRDCYCTVNLDQEEVFRTKIVEKSLCPF
YGEDFYCEIPRSFRHLSFYIFDRDVFRRDSIIGKVAIQKEDLQKYHNRDTWFQLQHVDAD
SEVQGKVHLELRLSEVITDTGVVCHKLATRIVECQGLPIVNGQCDPYATVTLAGPFRSEA
KKTKVKRKTNNPQFDEVFYFEVTRPCSYSKKSHFDFEEEDVDKLEIRVDLWNASNLKFGD
EFLGELRIPLKVLRQSSSYEAWYFLQPRDNGSKSLKPDDLGSLRLNVVYTEDHVFSSDYY
SPLRDLLLKSADVEPVSASAAHILGEVCREKQEAAVPLVRLLLHYGRVVPFISAIASAEV
KRTQDPNTIFRGNSLASKCIDETMKLAGMHYLHVTLKPAIEEICQSHKPCEIDPVKLKDG
ENLENNMENLRQYVDRIFHAITESGVSCPTVMCDIFFSLREAAAKRFQGDPDVRYTAVSS
FIFLRFFAPAILSPNLFQLTPHHTDPQTSRTLTLISKTVQTLGSLSKSKSASFKESYMAT
FYEFFNEQKYADAVKNFLDLISSSGRRDPKSVEQPILLKEGLMIKRAQGRKRFGMKNFKK
RWFRLTNHEFTYHKSKAGDQPLYSIPIENILAVEKLEEESFKMKNMFQVIQPERALYIQA
NNCVEAKDWIDILTKVSQCNQKRLTVYHPSAYLSGHWLCCRAPSDSAPGCSPCTGGLPAN
IQLDIDGDRETERIYSLFNSYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKT
LKQIIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI
Download sequence
Identical sequences ENSPANP00000005151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]