SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005213 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005213
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-20
Family Ubiquitin-related 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005213   Gene: ENSPANG00000010838   Transcript: ENSPANT00000004532
Sequence length 197
Comment pep:known_by_projection chromosome:PapAnu2.0:X:141836284:141839149:-1 gene:ENSPANG00000010838 transcript:ENSPANT00000004532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYS
IGPNSKLNLVVKPLQKVLLEEGEAQRLADSPPPHVWQLISKVLARHFSAADASRVLEQLQ
RDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSKDTLVSMGGLQRRMKRWLPAASTE
SLPHCLTARAAPSLEHL
Download sequence
Identical sequences ENSPANP00000005213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]