SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005220 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005220
Domain Number 1 Region: 282-403
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000636
Family Synaptotagmin-like (S variant) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005220   Gene: ENSPANG00000012107   Transcript: ENSPANT00000019534
Sequence length 708
Comment pep:known_by_projection chromosome:PapAnu2.0:14:108445559:108454034:1 gene:ENSPANG00000012107 transcript:ENSPANT00000019534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPGWGQRDVGWVALLILFAASLLTVFAWLLQYARGLWLARARGNRGPGPALAGEPAGSL
RELGVWRSLLRLRATRAGAAEEPGVRGLLASLFAFKSFRENWQRAWVRALNEQACRNGSS
IQIAFEEVPQLPPRASISHVTCVDQSEHTMVLRCQLSAEEVRFPVSVTQQSPAAVSMETY
HVTLTLPPTQLEVNLEEIPGEGLLISWAFTDRPDLSLTVLPKLQARERGEEQVELSTIEE
LIKDAIVSTQPAMMVNLRACSAPGGLVPSEKPPMLPQAQPAIPRPTRLFLRQLRASHLGN
ELEGTEELCCVAELDNPMQQKWTKPARAGPEVEWTEDLALDLGPQSRELTLKVLRSSSCG
DTELLGQATLPVGSPSRPLSRRQVCPLTPGPGKALGPAATMAVELQYDEGSPRNLGTPTS
STPRPSITPTKKIELDRTIMPDGTIVTTVTTVQSRPRIDGKLVLPSESPKSKVEVTEKTT
TVLSESSGPSNASHSSSPGDSHLSNGLDPVAETAIRQLTEPSGRAAKKTPTKRSTLIISG
VSKVPIAQDELALSLGYAASLEATMQDDAGTSGGPSSPPSDPPAMSPGPLDALSSPTSVQ
EADETTRSDISERPSVDDVESETGSTGALETRSLKDHKVSFLRSGTKLIFRRRPRQKEAG
LSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL
Download sequence
Identical sequences ENSPANP00000005220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]