SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005246 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005246
Domain Number 1 Region: 1229-1589
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 9.68e-123
Family Hect, E3 ligase catalytic domain 0.00000000972
Further Details:      
 
Domain Number 2 Region: 815-851
Classification Level Classification E-value
Superfamily WW domain 0.00000000000475
Family WW domain 0.0014
Further Details:      
 
Domain Number 3 Region: 216-314
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000637
Family Synaptotagmin-like (S variant) 0.065
Further Details:      
 
Domain Number 4 Region: 999-1041
Classification Level Classification E-value
Superfamily WW domain 0.000000000125
Family WW domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005246   Gene: ENSPANG00000022845   Transcript: ENSPANT00000025610
Sequence length 1595
Comment pep:known_by_projection chromosome:PapAnu2.0:3:67599844:67851031:-1 gene:ENSPANG00000022845 transcript:ENSPANT00000025610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLTVSLLPQNLYQNRFLGLAAMASPSRNSQSRRRCKEPLRYSYNPDQFHNMDLRGGPHDG
VTIPRSTSDTDLVTSDSRSTLMVSSSYYSIGHSQDLVIHWDIKEEVDAGDWIGMYLIGNI
DEVLSENFLDYKNRGVNGSHRGQIIWKIDASSYFVEPETKICFKYYHGVSGALRATTPSV
TVKNSAAPIFKSIGADETVQGQGSRRLISFSLSDFQAMGLKKGMFFNPDPYLKISIQPGK
HSIFPALPHHGQERRSKIIGNTVNPIWQAEQFSFVSLPTDVLEIEVKDKFAKSRPIIKRF
LGKLSMPVQRLLERHAIGDRVVSYTLGRRLPTDHVSGQLQFRFEITSSIHPADDEEISLS
TEPESAPIQDSPMNNLMESGSGEPRSEAPESSEGWKPEQLGEGSVLDGPGNQSMELSRPA
EEAAVITEAGDQGMVSVGPEGAGDLLAQVQKDIQPAPSAEELAEQLDLGEEASALLLEDG
EAPASTEEEPLEEEATTQSRDVSTLEQGEGRLQLRASVKRKSRPCSLPVSELETVIASAC
GDPETPRTHYIRIHTLLHSMPSAQGGSAAEEEDGEEESTLKDSSEKDGLSEVDTVAADPS
ALEEDREEPEGATPGMAHPGHSGGHFSSLANGAAQDGDTHPSTGSESDSSPRQGGDHSCE
GCDASCCSPSCYSSSCYSTSCYSSSCYSASCYSPSCYNGNRFASHTRFSSVDSAKISEST
VFSSQDDEEEENSAFESVPDSMQSPELDPESTNGAGPWQDELAAPSGHVERTPEGLESPV
AGPSNRREGECPILHNSQPVSQLPSLRPEHHHYPTIDEPLPPNWEARIDSHGRVFYVDHV
NRTTTWQRPTAAATPDGMRRSGSIQQMEQLNRRYQNIQRTIATERSEEDSGSQSCEQAPA
GGGGGGGSDSEAESSQSSLDLRREGSLSPVNSQKITLLLQSPAVKFITNPEFFTVLHANY
SAYRVFTSSTCLKHMILKVRRDARNFERYQHNRDLVNFINMFADTRLELPRGWEIKTDQQ
GKSFFVDHNSRATTFIDPRIPLQNGRLPNHLTHRQHLQRLRSYSAGEASEVSRNRGASLL
ARPGHSLVAAIRSQHQHESLPLAYNDKIVAFLRQPNIFEMLQERQPSLARNHTLREKIHY
IRTEGNHGLEKLSCDADLVILLSLFEEEIMSYVPLQAAFHPGYSFSPRCSPCSSPQNSPG
LQRASARAPSPYRRDFEAKLRNFYRKLEAKGFGQGPGKIKLIIRRDHLLEGTFNQVMAYS
RKELQRNKLYVTFVGEEGLDYSGPSREFFFLLSQELFNPYYGLFEYSANDTYTVQISPMS
AFVENHLEWFRFSGRILGLALIHQYLLDAFFTRPFYKALLRLPCDLSDLEYLDEEFHQSL
QWMKDNNITDILDLTFTVNEEVFGQVTERELKSGGANTQVTEKNKKEYIERMVKWRVERG
VVQQTEALVRGFYEVVDSRLVSVFDARELELVIAGTAEIDLNDWRNNTEYRGGYHDGHLV
IRWFWAAVERFNNEQRLRLLQFVTGTSSVPYEGFAALRGSNGLRRFCIEKWGKITSLPRA
HTCFNRLDLPPYPSYSMLYEKLLTAVEETSTFGLE
Download sequence
Identical sequences ENSPANP00000005246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]