SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005282 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005282
Domain Number 1 Region: 282-426
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 7.06e-35
Family Outer arm dynein light chain 1 0.0011
Further Details:      
 
Domain Number 2 Region: 24-118
Classification Level Classification E-value
Superfamily PX domain 5.63e-22
Family PX domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005282   Gene: ENSPANG00000026093   Transcript: ENSPANT00000021867
Sequence length 1462
Comment pep:known_by_projection chromosome:PapAnu2.0:2:82784086:82822479:-1 gene:ENSPANG00000026093 transcript:ENSPANT00000021867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATARTFGPEREAEPAKEARVLGSELVDTYTVYIIQVTDGSHEWTVKHRYSDFHDLHEKL
VAERKIDKNLLPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFY
EINGITAALAEELFEKGEQLLGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHI
LDFTCRLKYLKVSGTEGPFGTSNIQEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVASKP
TLATLSVRFSATSMKEVLVPEASEFDEWEPEGTALEGPVTAVIPTWQALTTLDLSHNSIS
EIDESVKLIPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSSLEGLHTKLGNIKTL
NLAGNLLESLSGLHKLYSLVNLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPLSIIPDY
RTKVLAQFGERASEVCLDDTVTTEKELDTVEVLKAIQKAKEVKSKLSNPEKRGGEDSRLS
AAPCIRPSSSPPTVAPASASLPQPILSNQGIVFVQEEALASSLSSTDSLTPEDQPIAQGC
SNSLESIPAGQAASDDLRDMPGAVGGASPDHAEPEVQVVPGSGQIIFLPFTCIGYTATNQ
DFIQRLSTLIRQAIERQLPAWIEAANQHVAENRYFEMGPPDRLALEWALGADEDFLLEHI
RILKVLWCFLIHVQGSIRQFAACLVLTDFGIAVFEIPHQESRGSSQHILSSLRFVFCFPH
GDLTEFGFLMPELCLVLKVRHSENTLFIISDAANLHEFHADLRSCFAPQHMAMLCSPILY
GSHTSLQEFLRQLLTFYKVAGGCQERSQGCFPVYLVYSDKRMVQTAAGDYSGNIEWASCT
LCSAVRRSCCAPSEAVKSAAIPYWLLLTPQHLNVIKADFNPMPNRGTHNCRNRNSFKLSR
VPLSTVLLDPTRSCTQPRGAFADGHVLELLVGYRFVTAIFVLPHEKFHFLRIYSQLRASL
QDLKTVVIAKTPGTGGSPQGPFADGQPAERRVRGYSNDQRPQEVPAEALAPAPAEVPAPA
PAAASASGPGKTPAPAETSTSTLVPEETPVEAPAPPPAEAPAQYPSEHLIQATSEENQIP
SHLPACPSLRHVASLRGSAIIELFHSSIAEVENEELRHLMWSSVVFYQTPGLEVTACVLL
STKAVYFVLHDGLRRYFSEPLQDFWHQKNTDYNNSPFHISQCFVLKLSDLQSVNVGLFDQ
HFRLTGSTPVQVVTCLTRDSYLTHCFLQHLMVVLSSLERTPSPEPVDKDFYSEFGNKTTG
KMENYELIHSSRVKFTYPSEEEIGDLTFIVAQKMAEPEKAPALSILLYVQAFQVGMPPPG
CCRGPLRPKTLLLTSSEIFLLDEDCIHYPLPEFAKEPPQRDRYRLDDGRRVRDLDRVLMG
YQTYPQALTLVFDDVQGHDLMGSVTLDHFGEVPGGPARAGQGREVQWQVFVPSAESREKL
ISLLARQWEALCGRELPVELTG
Download sequence
Identical sequences ENSPANP00000005282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]