SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005299 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005299
Domain Number 1 Region: 308-386
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.96e-22
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 2 Region: 78-112
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000022
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005299
Domain Number - Region: 190-304
Classification Level Classification E-value
Superfamily Prefoldin 0.00126
Family Prefoldin 0.0099
Further Details:      
 
Domain Number - Region: 145-212
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.0745
Family Sec2 N-terminal region 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005299   Gene: ENSPANG00000006157   Transcript: ENSPANT00000006623
Sequence length 400
Comment pep:novel scaffold:PapAnu2.0:JH685324.1:8578:9777:1 gene:ENSPANG00000006157 transcript:ENSPANT00000006623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSYSYLQWSAMSSVGGLGGGSVRFGPGVAFRAPSMHGGSDGRGVSVSSARFVSSSSSGG
YGGGYGGVLAASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQG
PEPSRDYSHYYTTIQDLRDNILGATIENSRIVLQIENARLAADDFRTKFETEQALRMSLE
ADINGLCRVLEELTLARTDLEMQIEGLKEELAYLKKNHEEEISVLRGLVGGQVSVEVDSA
PGTDLATILNDIRNQYQVMAEQNRKDTEAWFTSRTEESNRELSGHTEQLQISRSEVTDLR
RTLQGLEIELQSQLSMKAALEDTLAETEVRFGAQLAHIQALISGVEAQLGDVRADSERQN
QEYQRLMDIKSRLEQEIATYRSPLKGQEDHYNNLPASKDL
Download sequence
Identical sequences ENSPANP00000005299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]