SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005329 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005329
Domain Number 1 Region: 43-243
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.38e-64
Family Arfaptin, Rac-binding fragment 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005329   Gene: ENSPANG00000017467   Transcript: ENSPANT00000023713
Sequence length 447
Comment pep:known_by_projection chromosome:PapAnu2.0:12:64673304:64739559:-1 gene:ENSPANG00000017467 transcript:ENSPANT00000023713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSFGQPRPEDNQSVVSRMQKKYWKTKQVFIKATGKKEDEHLVASDAELDAKLEVFHSVQ
ETCTELLKIVEKYQLRLNVISEEENELGLFLKFQAERDATQAGKMMDATGKALCSSAKQR
LALCTPLSRLKQEVATFSQRAVSDTLMTINRMEQARTEYRGALLWMKDVSQELDPDTLKQ
MEKFRKVQMQVRNSKASFDKLKMDVCQKVDLLGASRCNMLSHSLTTYQRTLLGFWEKTAR
MMSQIHEACIGFHPYDFVALKQLQDTPSKLTEDNKYEQIGGFLTEQLNKLVLSDEEASCE
REQANKDHKETHSQMREFGAPQFSNSENVAKDLPVDSLEGEDFEKEFSFLNNLLSSGSSS
TSEFTQECQTAFGSPSASLTSQEPSMGSEPLAHSSRFLPSQLFDLGFHAAGAFNNWVSQE
ESELRLSHTDNQPVPSQSPKKLTRCKE
Download sequence
Identical sequences ENSPANP00000005329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]