SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005336 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005336
Domain Number 1 Region: 20-129
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-25
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 214-320
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 7.11e-20
Family Platelet-derived growth factor-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005336   Gene: ENSPANG00000017124   Transcript: ENSPANT00000006015
Sequence length 328
Comment pep:known_by_projection chromosome:PapAnu2.0:14:93479746:93568334:-1 gene:ENSPANG00000017124 transcript:ENSPANT00000006015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESNHLTDLYRRDETIQVKGNGFVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGL
EEAENDICRYDFVEVEDVSETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKP
GFKIYYSLVEDFQPAAASETNWESVTSSISNESYNSGTVTNPFPKTECLQFSLCLFDLAK
KPFANTNGESYQSFLRFVPMDVPRKPGHLHSKWSSVDLDRLNDDAKRYSCTPRNYSVNIR
EELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRKG
RAKAMALVDIQLDHHERCDCICSSRPPR
Download sequence
Identical sequences ENSPANP00000005336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]