SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005347 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005347
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily PX domain 1.83e-24
Family PX domain 0.002
Further Details:      
 
Domain Number 2 Region: 264-339
Classification Level Classification E-value
Superfamily MIT domain 1.31e-16
Family MIT domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005347   Gene: ENSPANG00000013648   Transcript: ENSPANT00000016312
Sequence length 342
Comment pep:known chromosome:PapAnu2.0:14:9041165:9053756:-1 gene:ENSPANG00000013648 transcript:ENSPANT00000016312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQAKDDFLRHYTVSDPRTHPKGYTEYKVTAQFISKKDPEDVKEVVVWKRYSDFRKLHG
DLAYTHRNLFRRLEEFPAFPRAQVFGRFEASVIEERRKGAEDLLRFTVHIPALNNSPQLK
EFFRGGEVTRPSEMSRDLHILPPPLIPTPPPDDPRLPQPLPAERRGLEELEVPVDPPPSS
PAQEALDLLFNCESTEEASGSPARGPLTEAELALFDPFSKEEGAAPSPTHVAELATMEME
SARLDQEPWEPGGQEEEEDGEGGPTPAYLSQATDLITRALRDEKAGAYAAALQGYRDGVH
VLLQGVPSDPLPARQEGVKKKAAEYLKRAEEILHLHLSQLPP
Download sequence
Identical sequences B0CM75
ENSPANP00000005347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]