SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005357 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005357
Domain Number 1 Region: 12-179
Classification Level Classification E-value
Superfamily EF-hand 6.28e-45
Family Penta-EF-hand proteins 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005357   Gene: ENSPANG00000005576   Transcript: ENSPANT00000010646
Sequence length 184
Comment pep:known_by_projection chromosome:PapAnu2.0:1:33837112:33839833:-1 gene:ENSPANG00000005576 transcript:ENSPANT00000010646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFTPLPPGGAPPNVDPEAYSWFQSVDSDHSGYISMKELKQALVNCNWSSFNDETCLMMI
NMFDKTKSGRIDVYGFSALWKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQ
FTQLLVSRYCPRSANPAMQLDRFIQVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTA
SRML
Download sequence
Identical sequences ENSPANP00000005357 XP_016857170.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]