SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005358 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005358
Domain Number 1 Region: 123-223
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-31
Family SH2 domain 0.0000764
Further Details:      
 
Domain Number 2 Region: 68-119
Classification Level Classification E-value
Superfamily SH3-domain 0.00000179
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005358   Gene: ENSPANG00000011557   Transcript: ENSPANT00000001073
Sequence length 317
Comment pep:known_by_projection chromosome:PapAnu2.0:8:127962357:127984848:-1 gene:ENSPANG00000011557 transcript:ENSPANT00000001073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLSKLGHSPLGGLRARLTFPVCLLYRRLWASPAAPGKKKEMGNSMKSAPAPAERPLPNP
EGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVAR
VYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPN
NWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASNSPVTLRQKTV
DWRRMSRLHENPEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSVSLMYS
GSKRKSSFFSSPPYFED
Download sequence
Identical sequences A0A2K5W9Z8
XP_005564170.1.63531 XP_011758401.1.29376 ENSPANP00000005358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]