SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005388 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005388
Domain Number 1 Region: 108-228
Classification Level Classification E-value
Superfamily EF-hand 1.21e-36
Family Osteonectin 0.01
Further Details:      
 
Domain Number 2 Region: 197-290
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.02e-29
Family Thyroglobulin type-1 domain 0.00078
Further Details:      
 
Domain Number 3 Region: 37-91
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000263
Family Ovomucoid domain III-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005388   Gene: ENSPANG00000006370   Transcript: ENSPANT00000008021
Sequence length 361
Comment pep:known_by_projection chromosome:PapAnu2.0:5:156129445:156379618:-1 gene:ENSPANG00000006370 transcript:ENSPANT00000008021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCSRHKVCIAQDSQTAVCISHRRLTHRMKEAGVDHRQWRGPILSTCKQCPMVYPSPVCG
SDGHTYSFQCKLEYQACVLGKQISVKCEGHCPCPSDKPTSTSRNVERACSDLEFREVANR
LRDWFKALHESGSQNKKTKTLLRTERSRFDTSILPICKDSLGWMFNRLDTNYDLLLDQSE
LRSIYLDKNEQCTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCQTELSNIQKRQGVKK
LLGQYIPLCDEDGYYKPTQCHGSVGQCWCVDRYGNEVMGSRINGVADCAIDFEISGDFAS
GDFHEWTDDEDDEDDIXXXXXXXXXXXXXXXXXLKVKNLVVLSNVYFNLDGSLMQIFKNI
L
Download sequence
Identical sequences ENSPANP00000005388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]