SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005422 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005422
Domain Number 1 Region: 304-425
Classification Level Classification E-value
Superfamily EF-hand 5.24e-33
Family Osteonectin 0.0093
Further Details:      
 
Domain Number 2 Region: 213-285
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.09e-20
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 3 Region: 75-152
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.81e-16
Family Thyroglobulin type-1 domain 0.0013
Further Details:      
 
Domain Number 4 Region: 40-86
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000402
Family Ovomucoid domain III-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005422   Gene: ENSPANG00000011796   Transcript: ENSPANT00000008976
Sequence length 448
Comment pep:known_by_projection chromosome:PapAnu2.0:4:163473421:163690321:1 gene:ENSPANG00000011796 transcript:ENSPANT00000008976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPQLCWLLLLAVLLQPVPAQKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTF
LSRCEFQRAKCKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYS
QVIQCHSYTGYCWCVTPNGRPISGTAVAHKTPGARTCSINEKLPQREGTGKTDDAAAPAL
ETQPQGDEEDIASRYPTLWTEQVKSRQNKTNKNSVSSCDQEHQSALEEAKQPKNDNVVIP
ECAHGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPKCDNTARAHPAKARDLYKG
RQLQGCPGAKKHEFLTSILDALSTDMVHAVSDPSSSSGRLSEPDPSHTLEERVVHWYFKL
LDKNSSGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDVNNDKSISVQELMGCLGVAKE
DGKADTKKRHTPRGNAESTSNRQPRKQG
Download sequence
Identical sequences ENSPANP00000005422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]