SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005429 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005429
Domain Number 1 Region: 4-33
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000461
Family Erythroid transcription factor GATA-1 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005429   Gene: ENSPANG00000006522   Transcript: ENSPANT00000020151
Sequence length 271
Comment pep:known_by_projection chromosome:PapAnu2.0:3:109554101:109563098:-1 gene:ENSPANG00000006522 transcript:ENSPANT00000020151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLGLKPTCSVCKTTSSSMWKKGTQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSSGGGG
GFGAATFASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRR
HIFKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQY
CEKSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFP
TVPTRPEKGYIWTHVGPTPAITIKETVANHL
Download sequence
Identical sequences A0A2K5V7X5 H9H3D2
ENSPANP00000005429 ENSMMUP00000013210 NP_001253080.1.72884 XP_005595582.1.63531 ENSMMUP00000013210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]