SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005438 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005438
Domain Number 1 Region: 444-511,713-819
Classification Level Classification E-value
Superfamily PH domain-like 1.68e-22
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 
Domain Number 2 Region: 57-72,99-337
Classification Level Classification E-value
Superfamily ARM repeat 0.000000341
Family MIF4G domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005438   Gene: ENSPANG00000010193   Transcript: ENSPANT00000027638
Sequence length 833
Comment pep:known_by_projection chromosome:PapAnu2.0:2:128657677:128886835:1 gene:ENSPANG00000010193 transcript:ENSPANT00000027638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQLFRLVLGQKDLSRAGDLFSLDDSEIEDSLTEALEQIKIISSSPDYQTNNNDQAVVEI
CITRITTAIRETESIEKHAKALVGLWDSCLEHNLRPFGKDEDTPHAKIASDIMSCILQNY
NRPPVMALAIPIAVKFLHRGNKELCRNMSNYLSLAAITKADLLADHTEVIVKSILQGNTM
LLRVLPAVYEKQPQPIKRHLTELLALMSQLEQPEQYHLLRLLHVAAKKKQLEVVQKCIPF
LIGHLKDSTHNDIILNILIEIAGYEPVALNGFLPMLKEIGERFPYLIGQMARIYGAVGHV
DEERARSCLTYLVSQLANMEHSFHHILLLEIKGITDTFSSILGPQSRDIFRMSNSFTAIA
KLLTRQLENAKAGSGRRKISTEIEFPEKLEETKLIVAENEDHEKLQVKIQAFEDKINADS
NTLGSIRRYSLGQVSKEERKNIRFNRSKSLALHTVLTKGVGSDDGEDENRRDIPASISLS
EIDPLSQGNDKLLFKADTDRSQLGESSVSYPNIIHKDSENLPETVKENFQEETPETTASP
IEYQDKLYLHLKKNLSKVKAYAMEIGKKIPVPDQCTIEDTVRSCVAKLFFTCSLKGHYCL
YSKSSFILISQEPQPWIQIMFLFQQSLFPEPLSIQSHSVQFLRALWEKTQAGDAHSFETA
MMESTFPQQKDLDQVQLHLEEVRFFDVFGFSETAGAWQCFMCNNPEKATVVNQDGQPLIE
GKLKEKQVRWKFIKRWKTRYFTLAGNQLLFQKGKSKDDPDDCPIELSKVQSVKAVAKKRR
DRSLPRAFEIFTDNKTYVFKAKDEKNAEEWLQCINVAVAQAKERESREVTTYL
Download sequence
Identical sequences A0A096MZN2
ENSPANP00000005438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]