SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005452 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005452
Domain Number 1 Region: 13-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.03e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 125-312
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.64e-38
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 3 Region: 336-527
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.88e-33
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 4 Region: 553-611
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000272
Family Fibrinogen C-terminal domain-like 0.003
Further Details:      
 
Domain Number 5 Region: 524-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000483
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005452   Gene: ENSPANG00000008720   Transcript: ENSPANT00000022898
Sequence length 668
Comment pep:known_by_projection chromosome:PapAnu2.0:3:168419764:169272439:1 gene:ENSPANG00000008720 transcript:ENSPANT00000022898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEKCDEPLVSGLPHVAFSSSSSMTGSYSPGYAKINKRGGAGGWSPSDSDHYQWLQVDFGN
RKQISAIATQGRYSSSDWVTQYRMLYSDTGRNWKPYHQDGNIWAFPGNVNSDGVVRHELQ
HPVIARYVRIVPLDWNGEGRIGLRIEVYGCSYWADVINFDGHVVLPYRFRNKKMKTLKDV
IALKFKTSESEGVILHGEGQQGDYITLELKKAKLVLSLNLGSNQLGPIYGHTSVMTGSLL
DDHHWHSVVIERQGRSINLTLDRSMQHFRTNGEFDYLDLDYEITFGGIPFSGKPSSSGRK
NFKGCMESINYNGINITDLARRKKLEPSNVGNLSFSCVEPYTVPVFFNATSYLEVPGRLN
QDLFSVSFQFRTWNPNGLLVFSHFADNLGNVEIDLTESKVGVHINITQTKMSQIDISSGS
GLNDGQWHEVRFLAKENFAILTIDGDEASAVRTNSPLQVKTSEKYFFGGFLNQMNNSSHS
VLQPSFQGCMQLIQVDDQLVNLYEVAQRKPGSFANVSIDMCAIIDRCVPNHCEHGGKCSQ
TWDSFRCTCDETGYSGATCHNSIYEPSCEAYKHLGQTSNYYWIDPDGSGPLGPLKVYCNM
TEDKVWTIVSHDLQMQTNVVAYNPEKYSVTQLVYSASMDQISAITDSAEYCEQYVSYFCK
MSRLLNTP
Download sequence
Identical sequences ENSPANP00000005452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]