SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005479 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005479
Domain Number 1 Region: 29-148
Classification Level Classification E-value
Superfamily FKBP-like 1.24e-42
Family FKBP immunophilin/proline isomerase 0.000000627
Further Details:      
 
Domain Number 2 Region: 258-414
Classification Level Classification E-value
Superfamily TPR-like 3.56e-34
Family Tetratricopeptide repeat (TPR) 0.0000000911
Further Details:      
 
Domain Number 3 Region: 142-257
Classification Level Classification E-value
Superfamily FKBP-like 5.7e-28
Family FKBP immunophilin/proline isomerase 0.000000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005479   Gene: ENSPANG00000010527   Transcript: ENSPANT00000005825
Sequence length 458
Comment pep:known_by_projection chromosome:PapAnu2.0:11:2882405:2890832:1 gene:ENSPANG00000010527 transcript:ENSPANT00000005825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEEMKATESGAQSAPLPIEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGW
LLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPP
KIPPSATLVFEVELFEFKGEDLTEEEDGGIIRRIRTRGEGYAKPNEGAIVEVALEGYYKD
QLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPN
AELKYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWL
EYESSFSSEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRG
EAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAE
EENKAKAEASSGDHPTDEMKEEQKSNTAGSQSQVETEA
Download sequence
Identical sequences ENSPANP00000005479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]