SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005484 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000005484
Domain Number - Region: 419-470
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.051
Family Apolipoprotein A-I 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005484   Gene: ENSPANG00000016081   Transcript: ENSPANT00000012706
Sequence length 638
Comment pep:known_by_projection chromosome:PapAnu2.0:18:25833765:26216392:-1 gene:ENSPANG00000016081 transcript:ENSPANT00000012706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESERDMYRQFQDWCLRTYGDSGKTKTVTRKKYERIVQLLNGSESSSTDNAKFKFWVKSK
GFQLGQPDEVRGGGGGAKQVLYVPVKTTDGVGVDEKLSLRRVAVVEDFFDIIYSMHVETG
PNGEQIRKHAGQKRTYKAISESYAFLPREAVTRFLMSCSECQKRMHLNPDGTDHKDNGKP
PTLVTSMIDYNMPITMAYMKHMKLQLLNSQQDEDESSIESDEFDMSDSTRMSAVNSDLSS
NLEERMQSPQNLHGQQDDDSAAESFNGNETLGQSSIASGGTHSREMGDSNSDGKTGLEQD
EQPLNLSDSPLSAQLTSEYRIDDHNSNGKNKYKNLLISDLKMEREARENGSKSPAHSYSS
YDSGKNESVDRGAEDLSLNRGDEDEDDHEDHDDSEKVNETDGVEAERLKAFNMFVRLFVD
ENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQERARKRIRTYLKSCRRMKRSGFEMSRPI
PSHLTSAVAESILASACESESRNAAKRMRLERQQDESAPADKQCKPEATQATYSTSAVPG
SQDVLYINGNGTYSYHSYRGLGGGLLNLNDASSSGPTDLSMKRQLATSSGSSSSSNSRPQ
LSPTEINAVRQLVAGYRESAAFLLRSADELENLILQQN
Download sequence
Identical sequences A0A096MZS7 A0A0D9RZ74 A0A2K5MBT8 A0A2K6KI48 G7NKK8 G7PWM6
9544.ENSMMUP00000041282 NP_001181150.1.72884 XP_005586989.1.63531 XP_007972504.1.81039 XP_011930217.1.92194 XP_017729555.1.44346 ENSMMUP00000041282 ENSMMUP00000022728 ENSPANP00000005484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]