SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005487 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005487
Domain Number 1 Region: 159-245,306-371
Classification Level Classification E-value
Superfamily TPR-like 8.01e-20
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Domain Number 2 Region: 391-544
Classification Level Classification E-value
Superfamily TPR-like 0.0000000209
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005487
Domain Number - Region: 38-112
Classification Level Classification E-value
Superfamily TPR-like 0.000246
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005487   Gene: ENSPANG00000009324   Transcript: ENSPANT00000018883
Sequence length 566
Comment pep:known_by_projection chromosome:PapAnu2.0:1:5618012:5640998:-1 gene:ENSPANG00000009324 transcript:ENSPANT00000018883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQRSPRARPSRAQGRREAAETGGPSTQEGDARGVHQLATLLMELDSEDEASCLLAADAL
YRLGRLEETHKALLVALSRRPQAAPVLARLALLQLRRGFCYDANQLVKKLVQSGDTACLQ
PTLDVFCHEDRQLLQGHCHARALAILRARPGGADGRAHTKEAIAYLSLAIFAAGSQASES
LLARARCYGFLGQKKTAMFDFNAVLRAEPENVQALCGRALVHLALDQLQEAVDDILSALK
LGPGTVVPELRSLKPEAQALITQGLYSRCRALLSQLLDTGAPLEDEDTQGLLAVGQALIK
IDAGQLDWHLLLVDVLMARGSYEEAGTHLEKALHPAPTSEAARARLGLLRLKKGDVPAAA
RDLQGLAEVDAPDLSCLLHLLEASERQSLAQAAAWEAGTLLDAGQPRRALGYCSLSVLAG
GSSACHLRLRATCLAELQEFGRALRDLDHVLQETLGDSDLPRRVEDFCCQGRLLLSLGDQ
AAAAGAFVQALKLAPTLAQNSLRKQPGRAPTARLFLLRGQRCLEEQCHPEAWMAAESGLL
VDPDHRGLKRLKARIRREASAGCWLQ
Download sequence
Identical sequences ENSPANP00000005487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]