SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005499 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005499
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily Domain from hypothetical 2610208m17rik protein 1.44e-70
Family Domain from hypothetical 2610208m17rik protein 0.000000565
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005499
Domain Number - Region: 142-210
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0589
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005499   Gene: ENSPANG00000010415   Transcript: ENSPANT00000004240
Sequence length 305
Comment pep:novel chromosome:PapAnu2.0:1:142337394:142378050:1 gene:ENSPANG00000010415 transcript:ENSPANT00000004240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQK
KTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRNI
NFSIIDIIDINSDNSMGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDA
GQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFF
EFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQ
TLHKE
Download sequence
Identical sequences ENSPANP00000005499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]